Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

6,466 – 6,480 of 129,856 results

6,466

Invitrogen™ Human FRAP1 (mTOR), GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Accession Number	P42345
Regulatory Status	RUO
Gene Alias	2610315D21Rik; AI327068; angiopoietin-like factor CDT6; FK506 binding protein 12-rapamycin associated protein 1; FK506 binding protein 12-rapamycin associated protein 2; FK506-binding protein 12-rapamycin complex-associated protein 1; FKBP12-rapamycin complex-associated protein; FKBP12-rapamycin complex-associated protein 1; FKBP-rapamycin associated protein; FKBP-rapamycin associated protein (FRAP); FKBP-rapamycin-associated protein FRAP; flat; FRAP; FRAP1; FRAP2; Mammalian target of rapamycin; mechanistic target of rapamycin; mechanistic target of rapamycin (serine/threonine kinase); mechanistic target of rapamycin kinase; Mtor; m-TOR; mTORC1; Raft1; Rapamycin and FKBP12 target 1; rapamycin and FKBP12 target-1 protein; rapamycin associated protein FRAP2; rapamycin target protein 1; RAPT1; serine/threonine-protein kinase mTOR; SKS
Product Type	Protein
Molecular Weight (g/mol)	163.9 kDa
Common Name	mTOR
Storage Requirements	-80°C, Avoid Freeze/Thaw Cycles
Concentration	See Label
Name	Human FRAP1 (mTOR), GST Tag

6,467

Invitrogen™ Mouse Siglec-3 (CD33) Fc Chimera Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Purity or Quality Grade	>90% as determined by SDS-PAGE.
Conjugate	Unconjugated
Form	Lyophilized
Common Name	CD33
Molecular Weight (g/mol)	55-60 kDa
Gene Symbol	CD33
Endotoxin Concentration	<1.0 EU/μg
Sequence	Mouse CD33, amino acids Met1-Glu240 (Accession # Q63994-1) with a C-terminal human IgG1 Fc region
Expression System	HEK293 cells
For Use With (Application)	Control,Neutralization
Name	Mouse Siglec-3 (CD33) Fc Chimera
Accession Number	Q63994
Purification Method	Purified
Gene Alias	CD33; CD33 antigen; CD33 antigen (gp67); CD33 molecule; CD33 molecule transcript; FLJ00391; gp67; Myeloid cell surface antigen CD33; p67; sialic acid binding Ig-like lectin 3; sialic acid-binding Ig-like lectin 3; SIGLEC3; Siglec-3
Format	Lyophilized
Product Type	Protein
Gene ID (Entrez)	12489
Formulation	PBS with 0.01% mannitol, 5-8% trehalose, 0.01% Tween 80 and no preservative; pH 7.4
Protein Tag	Fc-tag
Recombinant	Recombinant

6,468

Promotions Available

R&D Systems™ Recombinant Human B7-H2 Isoform 3 Fc Avi-tag Protein

Biotinylated

Pricing & Availability

6,469

Novus Biologicals™ PSMG3 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	PSMG3
Molecular Weight (g/mol)	15.2kDa
Gene ID (Entrez)	84262
Formulation	Liquid. In 20mM Tris-HCl Buffer (pH 8.0) containing 10% Glycerol
Immunogen	PSMG3, 1-122aa. MGSSHHHHHHSSGLVPRGSHMEDTPLVISKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

6,470

Invitrogen™ SARS 3CL Protease His-tag Recombinant Protein

Recombinant Protein

Pricing & Availability

6,471

Invitrogen™ Human MST1R (RON), GST Tag Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Content And Storage	Storage Buffer: 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.5 mM EDTA, 0.02% Triton X-100, 2 mM DTT, 50% Glycerol Store at -80°C. At first use, aliquot and store at -80°C to avoid multiple freeze-thaws.
Conjugate	Unconjugated
Form	Liquid
Common Name	RON
Molecular Weight (g/mol)	74.8 kDa
KinaseFamily	MET (HGFR) Kinase Family
Concentration	See Label
Expression System	Insect cells
For Use With (Application)	Kinase Assay
Name	Human MST1R (RON), GST Tag
Accession Number	Q04912
Gene Alias	CD136; Cdw136; c-met-related tyrosine kinase; friend virus susceptibility 2; Fv2; Fv-2; macrophage stimulating 1 receptor; macrophage stimulating 1 receptor (c-met-related tyrosine kinase); macrophage-stimulating protein receptor; Macrophage-stimulating protein receptor alpha chain; Macrophage-stimulating protein receptor beta chain; MSP receptor; Mst1r; MST1R variant RON30; MST1R variant RON62; p185-Ron; protein tyrosine kinase 8; Protein-tyrosine kinase 8; PTK8; PTK8 protein tyrosine kinase 8; receptor protein tyrosine kinase, c-met-related; RON; RON variant E2E3; Stem cell-derived tyrosine kinase; STK
Protein Length	983-1400
Gene ID (Entrez)	4486
Formulation	50mM tris HCl with 0.5mM EDTA, 2mM DTT, 50% glycerol, 150mM NaCl, 0.02% Triton X-100 and no preservative; pH 7.5
Protein Tag	GST-tag
Species	Human
Recombinant	Recombinant

6,472

Novus Biologicals™ beta Amyloid 42 Peptide

A recombinant protein corresponding to human beta amyloid 42

Pricing & Availability
Specifications

Purity or Quality Grade	>85%
Gene Alias	AAA, Abeta, ABPP, AD1, alpha-sAPP, Amyloid-beta precursor protein, APPI, Beta-Amyloid Peptide(1-42), CTFgamma, CVAP, PN2, PreA4
Molecular Weight (g/mol)	M.W. Theoretical: 4.5 kDa
Gene ID (Entrez)	351
Formulation	Dry powder. SeeReconstitution Instructions for re-suspension instructions/protocol.
Gene Symbol	APP
Storage Requirements	Store at -70C. Avoid freeze-thaw cycles.
For Use With (Application)	Electron Microscopy,Immunomicroscopy,In vitro Assay,In vivo Assay,Western Blot
Protein	beta Amyloid 42

6,473

Novus Biologicals™ Recombinant Human ART4 Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>85%, by SDS-PAGE
Molecular Weight (g/mol)	28.8 kDa
Gene ID (Entrez)	420
Formulation	Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Gene Symbol	ART4
Storage Requirements	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Concentration	0.25 mg/ml
Cross Reactivity	ART4
For Use With (Application)	SDS-PAGE
Species	Human
Source	Baculovirus

6,474

Invitrogen™ SARS-CoV-2 Spike Protein S1/S2 (mutant) His-Avi Tag Recombinant Protein, Biotin

Recombinant Protein

Pricing & Availability

6,475

Novus Biologicals™ STARD3 Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

6,476

MilliporeSigma™ Monocyte Chemotactic Protein-1 (MCP-1) Rat Recombinant Protein

Pricing & Availability

6,477

Invitrogen™ Mouse CD52 Fc Chimera Recombinant Protein

Recombinant Protein

Pricing & Availability

6,478

Promotions Available

R&D Systems™ Recombinant Mouse BTNL6/Butyrophilin-like 6 Protein

Learn More About B7-related Butryophilins as Immune Modulators View Webinar

Pricing & Availability

6,479

Novus Biologicals™ TSPAN16 Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

6,480

Novus Biologicals™ G protein alpha inhibitor 1 Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability

Recombinant Proteins

Filtered Search Results

Narrow Results

R&D Systems™ Recombinant Human B7-H2 Isoform 3 Fc Avi-tag Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ PSMG3 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ beta Amyloid 42 Peptide Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human ART4 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ STARD3 Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

R&D Systems™ Recombinant Mouse BTNL6/Butyrophilin-like 6 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ TSPAN16 Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ G protein alpha inhibitor 1 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

R&D Systems™ Recombinant Human B7-H2 Isoform 3 Fc Avi-tag Protein

Novus Biologicals™ PSMG3 Protein

Novus Biologicals™ beta Amyloid 42 Peptide

Novus Biologicals™ Recombinant Human ART4 Protein

Novus Biologicals™ STARD3 Recombinant Protein Antigen

R&D Systems™ Recombinant Mouse BTNL6/Butyrophilin-like 6 Protein

Novus Biologicals™ TSPAN16 Recombinant Protein Antigen

Novus Biologicals™ G protein alpha inhibitor 1 Protein